SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00109.1|PACid:22055709 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00109.1|PACid:22055709
Domain Number 1 Region: 26-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000565
Family Classic zinc finger, C2H2 0.065
Further Details:      
 
Weak hits

Sequence:  Aquca_026_00109.1|PACid:22055709
Domain Number - Region: 345-376
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0692
Family N-utilization substance G protein NusG, C-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00109.1|PACid:22055709
Sequence length 401
Sequence
MGKNDFLTPKAIANRIKAKGLQKLRWYCQMCQKQCRDENGFKCHCMSEGHQRQMEVFGQN
PHRIVDGYSEEFEESFLEHMKRSHRFSRVAATVIYNEYIADRHHVHMNSTEWATLTEFVK
YLGRTGKCKVDETPKGWFMTYIDRGSETLLKERLKNKRLKSDVVEEERQERAIQKQIELA
AQVVPNALQQNGAVQTEVTESLLAVRSDPGAKIAFAFGSNGKPVAKENGESSSRVIFEEI
GSEKNEKKRKGYSNLSKGGNAGRSVLDELMKEEEKVKERSNRKDYWLCEGIIVKVMSKAL
SDKGYYKQKGMIIKVIDKYVGEIQMLDTKHVLRVDQAELETVIPQIGGLVKIVNGAYRGS
KARLMSVNTDKYSAKVQIEKGLYDGRVLEAVDYEDISKLAQ
Download sequence
Identical sequences A0A2G5D7E0
Aquca_026_00109.1|PACid:22055709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]