SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00132.1|PACid:22055695 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00132.1|PACid:22055695
Domain Number 1 Region: 166-329,516-660
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.54e-38
Family WD40-repeat 0.0041
Further Details:      
 
Domain Number 2 Region: 15-116
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000458
Family WD40-repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00132.1|PACid:22055695
Sequence length 805
Sequence
METLRVKRSNSIDWKPSAVIALATSVDDSKVAAAREDGSLEIWLVSPGSVGWHCQLTIHG
DPNSRVSSLVWCRSSNPSGRLLSSSIDGTISEWDLFDLKQKVLLNSIGVSIWQMAVEPLQ
ESLVSEYQHAVNGFANHQDTTSDDESSESDDDADSIELQLQAVLENPRVAIACDNGRVSL
YYVSESDGITYDKSLPRVEGRVLSVAWSLDAKLIISGSSDGCIRIWDAKLTHEIHRLTVG
PNICIWSLLSLRSGTIISADSTGSVQFWDSQHGALLQTHTYHKGDVNALAAAPSHNRVFS
AGSDGQVILYKLSIGPVGSGNDNSSTEPLGKWSYVGYVRAHTHDVRALTVAVPISREDNM
PVEKVRRVRQREKPIDFSYCKWAHLGVPMLISAGDDTKLFAYSIKEFTKFAPHDICPAPQ
RVPMQLVVKTVNDGASLLLVQYSSYLDILRVHVKGGVNPKRVVGKNTNTQLLVRVKSKAS
REIVCSTISSTGLFLAYSDHMKPSLLELKFSEVKSGVCVVNRKSLPQKLPYAHSMVFSID
SSKLIIAGHDRKIYVVDVDTSELLQTFTPCRDLDDDNLSPTEPPIIKMFTSSDGQWLAAV
NCFGDIYVFNIEIQRQHWFISRLDGASVTAGGFPPSNSNVLIITSSSNQVYAFDVEAKQL
GEWSRHHMCVLPRRFVEFPGEIVGLSFPPSSCSTSVIIYSARAMCLIDFGMPVEKDDGSY
LTNGLDATLKKLHNTPNNTGLKRRRKESGLDHNNKVKTNFEFGAFKDPVLFVGHLSKDSL
FVIEKPWRDVIQKFDAPVHRHIFGS
Download sequence
Identical sequences A0A2G5D7K4
Aquca_026_00132.1|PACid:22055695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]