SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00166.1|PACid:22055955 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00166.1|PACid:22055955
Domain Number 1 Region: 206-341
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000034
Family Quinoprotein alcohol dehydrogenase-like 0.0049
Further Details:      
 
Weak hits

Sequence:  Aquca_026_00166.1|PACid:22055955
Domain Number - Region: 73-227
Classification Level Classification E-value
Superfamily YWTD domain 0.00366
Family YWTD domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00166.1|PACid:22055955
Sequence length 657
Sequence
MPNRSFLLLLLLMVLGWALAGTTLSIREIEEYIIGFITKCRVRDLIVTFFSPVSVQEPTR
KTTYRLTKPFIGDDGKIYTCSERNLFAFESNGTIAWTLHLNYSCHVDIAPVSAGRGKVSV
LKISPSNNGNSESTVEVFFGDTSTTGGSEEIVGISVNPLSWFMVINVKNRGLFAYTLRGK
FLWSAGPVLYRFGYRQGCRKNATDCYFTSAPVIDQCEGSIYISNNWGELYSLSIRSPQFN
WIQDFSAYDELLIITAGNNGRVYVTVPVQALVFALDVYTGNVLWQNDIGPLSTTDCSPVV
DSNGWISIGSLDGFLYSFSPTGVSKKFPKVNDLDSVVQVSPFLDCSGYAMYISQTQMVGK
ITHTIGEHTYISSMKPINAVYTLLVPATGFVHWTRKFPGQFSTLLSDSDLHHFALDERIL
LGFIAANYTGSPFSCRTTSQKTASSCSQARVKHLSIYTGNERTILFFLLLQTLVLAVLAG
LVRFCCIFWRKKKLQNQDLGKFLEKRHSLRVKKKEFDRTITELEQKAAKEAVGTEVLDEL
GDLVREREGIERKLLTTYSLGRDRTKPQTPSLLPLYEGSTKSYSFQGRKKESVTIFHTLS
DTSSRERSTSDSGYSSNGSSHLQTEAESCSYYGDKESTAKTNAHAEAGPSSSAGMAE
Download sequence
Identical sequences A0A2G5D7N1
Aquca_026_00166.1|PACid:22055955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]