SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00190.2|PACid:22055947 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00190.2|PACid:22055947
Domain Number 1 Region: 2-189,225-247,334-416
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.66e-34
Family WD40-repeat 0.00088
Further Details:      
 
Weak hits

Sequence:  Aquca_026_00190.2|PACid:22055947
Domain Number - Region: 185-343
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00569
Family SGL-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00190.2|PACid:22055947
Sequence length 1081
Sequence
MCALFHPKEDLVVSASLDQTIRVWDIGALRKKGVSPADDSMRLSEMNSDLFGGVDAVVKY
VLEGHDRGVNWAAFHPTLPLIVSGADDRQIKLWRMNDTKAWEVDTLRGHGNNVSCVMFHA
KQDIIVSNSEDKSIRVWDVTKRIGIQTFRREHDRFWVLAFHPEMNLLAAGHDSGMIVFKL
ERERPAFSVSGDSLYYVKDRFLRIHDFYTQKDSQVIPIRRPGSLILNQGPRTLSFSPTEN
AVLLSSDVDGGCYELYILPKDSTGRGDALQDVMRGLGGSAVFVARNRFAVLDKINNHVIV
KNLKNDIVKKSSLPFAADAIFYAGTGNLLCRSEDRVIIFDLQQRIVLCDLQIPFIKYVAW
SSDMESVALLGKHVIIVANKKLEHQFTVHETIRVKSGAWDDNGVFIYTTLNHMKYCLPNG
DSGIIRTLDVPLYITKVSRNIVCCLDRNVKNCPISVDPTEYMFKLSLLKKKYDRIMSMIK
NSQLFGQAIIAYLQQKGYPEVALHLVKDERTRFNLALECGNIQTAVASANELDEKDHWYR
LGVEALRQGNASIVEYAYQKTKNFERLSFLYLITGNIEKLSKMMKIAEIKNDVMGQFHNS
LYLGDIHERVRVLEKAGHLPLAYITASVHGLKEDADRLGKELGDNIPSLPKGKVPSLLIP
PAPVLSCSDWPLLRVMKGIFEGGLDNIGKAGENEEDDEALDADWVEDLDIDDVIGMQNGN
VEILVENSDAIEGNDEEGGWDLEDLELPPEVATPKASINGRSVGFIAPTLGMPVSQIWIR
DSSLPAEHAAAGNFDTALRLLTRQLGIKNFIPLKPMFLDLYLGSQSYLRTFDSAPVISLE
IEKGSSETSGGSVPHAPALVFNFSRLDEKLKTAYKATTDGKFAEALRLFLNILQSIPLTV
VYSRREVDEVKEMILLAKEYVIGLKMEVMRKEVKDDMIRQQELAAYFTHCNLQTVHLRLA
LMNAMTICFKAGNYMTAANFSRRLLESNPPKEIQAKKARQVLQACERNMKDTTELNYDFR
NPFVVCGATYVPIYRGQKGVSCPYCGSRFVPSIEGKLCTVCDLAVVGADTSGLRCSPSQV
R
Download sequence
Identical sequences A0A2G5D8M7
Aquca_026_00190.2|PACid:22055947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]