SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00248.2|PACid:22055758 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00248.2|PACid:22055758
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily 14-3-3 protein 1.57e-85
Family 14-3-3 protein 0.0000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00248.2|PACid:22055758
Sequence length 217
Sequence
MSPTESSREENVYLAKLAEQAERYEEMVEFMENVAKTVDVEELTVEERNLLSVAYKNVIG
ARRASWRIISSIEQKEENRGNEEHVVVIKEYRGKIETELSKICDGILNLLDSHLVPSATA
AESKVFYLKMKGDYHRYLAEFKTGADRKEAAESTLLAYKSAQDIAVAELPPTHPIRLGLA
LNFSVFYYEILNSPDRACSLAKQDDAGDEIKEAPKPE
Download sequence
Identical sequences A0A2G5D8X9
Aquca_026_00248.2|PACid:22055758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]