SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00255.1|PACid:22056240 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00255.1|PACid:22056240
Domain Number 1 Region: 860-1129,1182-1214
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.6e-63
Family WD40-repeat 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00255.1|PACid:22056240
Sequence length 1218
Sequence
MAQIFEYFVVCGLGPEIRTLDGNKGYHGMGDMYLPSLLDQYPPSTHSLYPPPPPQLPTCV
LPAGVEIFSSGHNPNDVSTYPRSYPIVLTEGDGSKIYLSCIAFRDPVSEDIAEAYRVPAN
SFADKCICLVSHSPSFRVLREALEELFALCFSPDGSSKPLWDVIAYMVSKVPLPIPGKDR
VLFAIENCLLSADAPPKDGLPHADISFEPLVQCLDVDNLIKLFTAVLLERRVLIRSNKYS
LLTLVSEAICHLIYPFRWQHVYIPLLFFSGVDYIDAPTPYMMGLHSGVDTSGLTMDGVAV
VDLEYNRITTSEDIPPIPEPELSSLREDIMKLLYPKVVGIDQMKSQYDNSCEQFHKVGSK
PWGEEHDLQLRLIFLKFFASILSGYRNFIENTATQVFNTQAFLKKRSRSTNKPPDAMITQ
FLESQGFIDYLERGIGSDEKANNLLDKLQDTIGRGQNPFSILPSPSAEPEIITISDPGVG
ISGSGAKHCYDRFPSNIRTEEQEEKRKSILLAASGALENQGKHVSSSPMAMGRDSKAESL
SPRERAAERERMVLDIKVKLQGLWLRLLKLGATDDPLSSFEYGTILALIESDAEGIGGSG
FVECIREHIHSGWLCQLTEEQFIAVKELLKTAISRATSRNDISTVRDALEVSAEMYKKDS
NNVPDYVQRHLLSLSIWEELRFWEGYFEYLMEQSSNKSANYVSVVTAQLIIMASHMAGLG
LPDTDAWYMLETIADKNNIGYKHFIKLRGFLSHIQQLRIGYWGISSVKIPSASSYGLPSP
RSLDAADEDQQPAEASGIGRSWVQSMFSRDTASRANSFSRVRRWTSDNGTIATNENSKTT
ASPRKSDLPTAAQKKLQTSVRTLRGHTGAITALHCVTKREVWDLIGDREDAGFFISGSTD
CMVKIWDPSLRGSELRATLRGHTGSVRAISSDRGKVVSGSDDQSVLVWDKQTSQLLEELK
GHDAQVSCVRMLSGERVLTSSHDGSVKMWDVRTDTCVATVGRCSSAVLCMEYDDSTGILA
AAGRDAVANIWDIRAGRQMHKLLGHTKWIRSIRMVGDTIVTGSDDWTARMWSASRGTCDA
VLACHAGPVLCVEYSSSNRGIITGSTDGLLRFWENEEGGIRCVKNVTIHSAPVLSINAAE
HWLGIGAADNSMSLFHRPQEKLGGFTSAGSKMAGWQLYRTPQRTVAVVRCVASDLERKRI
CSGGRNGLLRLWDATINI
Download sequence
Identical sequences A0A2G5D842
Aquca_026_00255.1|PACid:22056240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]