SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00255.2|PACid:22056241 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00255.2|PACid:22056241
Domain Number 1 Region: 858-1114
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.56e-60
Family WD40-repeat 0.0000297
Further Details:      
 
Domain Number 2 Region: 1080-1212
Classification Level Classification E-value
Superfamily Nucleoporin domain 0.00000000314
Family Nucleoporin domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00255.2|PACid:22056241
Sequence length 1216
Sequence
MAQIFEYFVVCGLGPEIRTLDGNKGYHGMGDMYLPSLLDQYPPSTHSLYPPPPPQLPTCV
LPAGVEIFSSGHNPNDVSTYPRSYPIVLTEGDGSKIYLSCIAFRDPVSEDIAEAYRVPAN
SFADKCICLVSHSPSFRVLREALEELFALCFSPDGSSKPLWDVIAYMVSKVPLPIPGKDR
VLFAIENCLLSADAPPKDGLPHADISFEPLVQCLDVDNLIKLFTAVLLERRVLIRSNKYS
LLTLVSEAICHLIYPFRWQHVYIPLLFFSGVDYIDAPTPYMMGLHSGVDTSGLTMDGVAV
VDLEYNRITTSEDIPPIPEPELSSLREDIMKLLYPKVVGIDQMKSQYDNSCEQFHKVGSK
PWGEEHDLQLRLIFLKFFASILSGYRNFIENTATQVFNTQAFLKKRSRSTNKPPDAMITQ
FLESQGFIDYLERGIGSDEKANNLLDKLQDTIGRGQNPFSILPSPSAEPEIITISDPGVG
ISGAKHCYDRFPSNIRTEEQEEKRKSILLAASGALENQGKHVSSSPMAMGRDSKAESLSP
RERAAERERMVLDIKVKLQGLWLRLLKLGATDDPLSSFEYGTILALIESDAEGIGGSGFV
ECIREHIHSGWLCQLTEEQFIAVKELLKTAISRATSRNDISTVRDALEVSAEMYKKDSNN
VPDYVQRHLLSLSIWEELRFWEGYFEYLMEQSSNKSANYVSVVTAQLIIMASHMAGLGLP
DTDAWYMLETIADKNNIGYKHFIKLRGFLSHIQQLRIGYWGISSVKIPSASSYGLPSPRS
LDAADEDQQPAEASGIGRSWVQSMFSRDTASRANSFSRVRRWTSDNGTIATNENSKTTAS
PRKSDLPTAAQKKLQTSVRTLRGHTGAITALHCVTKREVWDLIGDREDAGFFISGSTDCM
VKIWDPSLRGSELRATLRGHTGSVRAISSDRGKVVSGSDDQSVLVWDKQTSQLLEELKGH
DAQVSCVRMLSGERVLTSSHDGSVKMWDVRTDTCVATVGRCSSAVLCMEYDDSTGILAAA
GRDAVANIWDIRAGRQMHKLLGHTKWIRSIRMVGDTIVTGSDDWTARMWSASRGTCDAVL
ACHAGPVLCVEYSSSNRGIITGSTDGLLRFWENEEGGIRCVKNVTIHSAPVLSINAAEHW
LGIGAADNSMSLFHRPQEKLGGFTSAGSKMAGWQLYRTPQRTVAVVRCVASDLERKRICS
GGRNGLLRLWDATINI
Download sequence
Identical sequences A0A2G5D834
Aquca_026_00255.2|PACid:22056241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]