SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00274.2|PACid:22056372 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00274.2|PACid:22056372
Domain Number 1 Region: 257-428
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 7.56e-45
Family CAT-like 0.00043
Further Details:      
 
Domain Number 2 Region: 56-145
Classification Level Classification E-value
Superfamily Single hybrid motif 1.01e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.00052
Further Details:      
 
Domain Number 3 Region: 186-229
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000183
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00274.2|PACid:22056372
Sequence length 431
Sequence
MASSLLCKITPTSNTISFSSSSSIPNGLIPFPYRRLSSTIIQIKKTPRKISPLQAKIREI
FMPALSSTMTEGKIVTWIKSEGDLLTKGESVVVVESDKADMDVETFYDGILAAIVVGEGE
TAPVGAPIGLLAETQDDIQEAKAKASKLGQGSATSPPPPSPPTAASSMASPPKVGSPPAP
ASASVSDGPKKIVATPFAKKLAKQHKIDLKSVTGTGPSGRITPADVETAAGISPQKSSVS
NVASPSPAATAAPSKAAAPSLPPIPGSTIVPFTTMQSAVSKNMLESLSVPTFRVGYPVMT
DALDALYEKVKPKGVTMTALLAKAAAMALAEHPVVNASCKDGKSFTYNSSINIAVAVAIN
GGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDA
ILPPGQVSDIA
Download sequence
Identical sequences A0A2G5D876
Aquca_026_00274.2|PACid:22056372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]