SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00288.3|PACid:22056285 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_026_00288.3|PACid:22056285
Domain Number - Region: 107-211
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0141
Family Myosin rod fragments 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00288.3|PACid:22056285
Sequence length 265
Sequence
MAGRNRAPRYTASNGPRGFRDGPRPVMTQGSRPLPLHPALLEEELEIRREDMRRIASENR
HLADDHMMLRRELAAAQDEIQRLGQVIPQLRADKELQARELIQKGLKLESELRATEPLKS
EVMKLRAESEKLSTVRQELSTKVQGLTKDLTRLQAENKQLPMMRADVDALHQELNRAREA
IEYEKKANVEQMEQKQAMEKNLISLARELEKLRVELSADPRGRGLGATYGVLKASSEMGY
ATGSAFGDGYTGGWGAYDRRGPPRH
Download sequence
Identical sequences A0A2G5D884
Aquca_026_00288.2|PACid:22056286 Aquca_026_00288.3|PACid:22056285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]