SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00384.1|PACid:22056021 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00384.1|PACid:22056021
Domain Number 1 Region: 90-189
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.09e-27
Family 2Fe-2S ferredoxin-related 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00384.1|PACid:22056021
Sequence length 205
Sequence
MNMAKFKLAQVGSLLVRELTRGQFTTTIQRRYLQRSYNQYLQSPVSPSPSNYKGISFSVY
SHAYNNRHAFSTSASDNGHEEGNQQKEKISVTFIDKGGEETHIKVPVGMSMLEAAHENDI
ELEGACEGSLACSTCHVIVMDVDYYNKLEDPTDEENDMLDLAFGLTETSRLGCQVIAKPE
LDGLRLALPAATRNFAVDGHVPKPH
Download sequence
Identical sequences A0A2G5D8T2
Aquca_026_00384.1|PACid:22056021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]