SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00390.1|PACid:22055772 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00390.1|PACid:22055772
Domain Number 1 Region: 14-127
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-33
Family alpha-D-mannose-specific plant lectins 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00390.1|PACid:22055772
Sequence length 139
Sequence
MATKFNISSALLLIALVFINSAIAEDILFSRETLNGGEFIENGPYRFIMQTDCNLVLYNG
NRVLWNSATNGRGTSCRATMQADGNLVILSGTTVVWSSGSARGPNDYRLIIQSDGNVVIY
GAALWATGTNTNGRARKLL
Download sequence
Identical sequences A0A2G5D8U1
Aquca_026_00390.1|PACid:22055772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]