SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00431.1|PACid:22055845 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00431.1|PACid:22055845
Domain Number 1 Region: 429-700
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-73
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 46-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-20
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 
Domain Number 3 Region: 157-247
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000615
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00431.1|PACid:22055845
Sequence length 719
Sequence
LPLYTSAQIYNNITLGLSITTLDENPYWTSPSGDFAFGFHPQQDLFLVATWYVKIPIKTI
FWTANNGKPIERGAKIQLTSNGVLSLTAPNGSETRIGQAIDNSQVTYAAILNTGNFVLST
KESKIVWATFDNPTDTILPNQVLDLGNKLSSRLTKDDYTIGRFELVLQGDGNLMLYSIAR
PKENTNTPYWRSDTLNNGSQLIFNQSGNIYLTLRSGGIHSLSSERPPSTEDYYQRATLDY
DGVFRQYTYPKISPNGRWPESCKLWEYGSGVCGFNSYCRLDEDQRPECGCPPGYTYLDPK
NTFRGCKPNFVLQVCETDELRIVDGFEMRDLPSTDWPFADYEWFKSVNEDWCRETCLIDC
FCAAAIIRGGNSSAERSPSTIYKENNEDDNWILPGSILLGISAVLNLLFLFLVIYSACYK
KQTRTQTDTRTFEANLRSFTYEELNEATDGFKEQLGKGASSTVYKGVLKSDFECLVAVKR
LDKVVEGNDKEFKAETSAIGKTNHKNLVQLVGFCNEETHRLLVYEFMMNGSLENFLFGSL
RLCWNQRIQIALGIARGLAYLHEECSSQIIHCDVKPQNILIDNSHVARISDFGLAKLLKS
DQTRTTTGIRGTRGYVAPEWFRNMPITTKVDVYSFGIMLLEIICCRKNCEPEALHLLVVN
DEEAKNDGKNLERMVMVALWCIQEEPSLRPSMKKVTQMLEGAVEVSMPPSPSSFICSTG
Download sequence
Identical sequences A0A2G5D8Y8
Aquca_026_00431.1|PACid:22055845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]