SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00432.1|PACid:22055704 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00432.1|PACid:22055704
Domain Number 1 Region: 495-785
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-76
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 61-150,180-214
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-24
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Domain Number 3 Region: 173-266
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000288
Family alpha-D-mannose-specific plant lectins 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00432.1|PACid:22055704
Sequence length 808
Sequence
MASFFHHLFCFLLLQLPLFISAQTYNNITLGTSISNLQENPYWTSPSGDFAFGFYPHQNL
FLLATWYSKIPVRTVVWTANDGKPVERGAKIELTSNGVLSLTTSNGTEIWKDEAIDNSQV
AYAAILDTGNFVLSTAESEFVWATFENPTDTILPNQILDFSKQTDTKLSSRVTEDDYTIG
KFELELQSDGNLVFYTIARPTQSRNEPYWASNTVNNGTQLVFNQTGYIYLTLRSGGIRSL
SSERPVSTEEYYQRATLDYDGVFRQYTYPKSSPRNGWPESWSTSWSLPQDICASSFGGVG
SGVCGFNSYCRRDVEQRPECLCPPGYIFIDPGNTFKGCKPNFTQQVCEADESRIVDGFEM
QELSNTDWPFADYEWFNNSVNQDWCEETCLKDCFCAAAISRGGSDCWLKKFPLSRGFMNP
SSDRIALIKVGNSSAEGNSSDRFPPTTVYNGNNEEKRNWILLGSSLLAISFALNLSLLIY
SACYKKQTKTQTATRSFGPNLRSFTYNELDEATDGFKEQLGMGAFSTVYKGVLKSDTGCL
VAVKRLDKVVQGNDKEFQAEVSAIGKTNHKNLVQLLGFCNEEAHRLLVYEFMVNGSLENF
LFGSSKLDWKKRIQIVFGIARGLAYLHEDCSSQIIHCDIKPQNILLDESYVARISDFGLA
KLLKSDQTRTTTGIRGTRGYVAPEWFRNMPITAKVDVYSFGIMLLEIICCRKNVEADVGD
EDIEILSDMAYECYEQKALYLLVADDEEAKNDGKSLESMIMVALWCIQEDPILRPTMKKV
TQMLEGVVEVSIPPSPNPSSFSNISPIG
Download sequence
Identical sequences A0A2G5D8X1
Aquca_026_00432.1|PACid:22055704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]