SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00003.2|PACid:22045954 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00003.2|PACid:22045954
Domain Number 1 Region: 427-570
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-31
Family MATH domain 0.0013
Further Details:      
 
Domain Number 2 Region: 87-227
Classification Level Classification E-value
Superfamily TRAF domain-like 1.96e-30
Family MATH domain 0.0022
Further Details:      
 
Domain Number 3 Region: 257-401
Classification Level Classification E-value
Superfamily TRAF domain-like 4.58e-24
Family MATH domain 0.0036
Further Details:      
 
Domain Number 4 Region: 594-719
Classification Level Classification E-value
Superfamily TRAF domain-like 1.32e-19
Family MATH domain 0.006
Further Details:      
 
Weak hits

Sequence:  Aquca_027_00003.2|PACid:22045954
Domain Number - Region: 1002-1152
Classification Level Classification E-value
Superfamily ARM repeat 0.00047
Family MIF4G domain-like 0.042
Further Details:      
 
Domain Number - Region: 1431-1493
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00003.2|PACid:22045954
Sequence length 1505
Sequence
QAVSCSSSPAEKQYQRQHHHHQHQQQSSSSSSRTCAAASLSSSSSSSSLTISPAEELVGA
GSREGSSGGGANGGQESVTVERRGDYSAVCKWTVQNFPKVKARALWSRYFEVGGYDCRLL
VYPKGDSQALPGYFSIYLQIMDPRSSSSSKWDCFASYRLSIVNHLDESKSIQRDSWHRFS
SKKKSHGWCDFTPSSSILDPKLGFLLSSNNIDSVLIIADILVLNESVSFSRDTHELQSSS
SSSVLGSTAVGPPLSEVLSGKFTWKVHNFSLFKDMIKTQKIMSSVFPAGECNLRISVYQS
SVNGIEHLSMCLESKDTEKSVVPDRSCWCLFRMSVLNQKPGSTHMHRDSYGRFAADNKSG
DNTSLGWNDYMKMLDFVGSESGFLVDDTAVFSASFHVIKESSSFSKNGGLLGMRTGGGGR
KSDGHLGKFTWRIENFTRLKDLLKKRKITGLCVKSRRFQIGNRDCRLIVYPRGQSQPPCH
LSVFLEVTDSRNTSSDWSCFVSHRLSVVNQKMEDKSVTKESQNRYSKAAKDWGWREFVTL
TSLFDQDSGFLVHDTVVFSAEVLILKETSTMQDFSSSDMESSNTGSQIEGAEKRGVFTWK
VENFLSFKEIMETRKIFSKFFQAGGCELRIGVYESFDTICIYLESDQSSGSDPDKNYWVR
YRMAVVNQKSPAKTVWKESSICTKTWNNSVLQFMKVSDMLEADAGFLVRDTVVFVCEILD
CCPWFEFSDLEVLASEDDQDALSTDPDELIDSEDSEGISGDEEDIFRNLLARAGFHLTYG
DNPSQPQVTLREKLLMDAGAIAGFLTGLRVYLDDPAKVKRLLLPTKLSCCNDGKKEVMRT
DESSPCLMNLLMGVKVLQQAIVDLLLDIMVECCQPSEGKSGEDSSDISTKTFADNNGAIS
PSESGSENAAVESLRIVHERLDSGVDENTIYAVQSSDMNGADVLKKTVPGQPICPPETSA
GSHAIDNGFTRAPKTKWPEQSEELLGLIVNSLRALDGAVPQGCPEPRRRPQSAQKIALVL
DKAPKHLQPDLVALVPKLVDHSEHPLAACALLDRLQKADGEPSLQLPVLGALSQLEFGSE
LWERVLYQAFKLLADSNHETLAAGLGYIFKAASHCQHLSQTVTVVRSKLKSLGSEVSDCV
LDVLSKSINSSIDVADAILRDIDSNFELGDGCLAAPSGLFLCNDMVNEQILRAGCHFSDI
FVLIEMLSIPSFAVEAAQAFERGVAQGAIMDQWLAMVLERRHVQRLSNSSRFIVESSQYK
DLVEEGKSNDSLPFQGFDFTPMLGLAETMALSRNPRVQGFVKILYSLLFRIYTDEGYRVR
MLKGLVDRATSSTDNSHVADLDLDILVFLVRQEEGIARPVLSMMREVAELANVDRAALWH
QLCASEDENIRIREERQVEVCNIVKEKDLLSHRLSESEATSSRLKSDMKVEVDRISREKK
ELSEQIQEVESQLEWLRSERDDEIAKLSSEKKVLQDRLYDAETQLSQLKSRKRDELKVGY
ISLSI
Download sequence
Identical sequences A0A2G5D4Q3
Aquca_027_00003.2|PACid:22045954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]