SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00003.3|PACid:22045955 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00003.3|PACid:22045955
Domain Number 1 Region: 83-208
Classification Level Classification E-value
Superfamily TRAF domain-like 9.65e-20
Family MATH domain 0.006
Further Details:      
 
Domain Number 2 Region: 4-59
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000213
Family MATH domain 0.0048
Further Details:      
 
Weak hits

Sequence:  Aquca_027_00003.3|PACid:22045955
Domain Number - Region: 491-641
Classification Level Classification E-value
Superfamily ARM repeat 0.000403
Family Exportin HEAT-like repeat 0.072
Further Details:      
 
Domain Number - Region: 920-1001
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00003.3|PACid:22045955
Sequence length 1187
Sequence
MEDKSVTKESQNRYSKAAKDWGWREFVTLTSLFDQDSGFLVHDTVVFSAEVLILKETSTM
QDFSSSDMESSNTGSQIEGAEKRGVFTWKVENFLSFKEIMETRKIFSKFFQAGGCELRIG
VYESFDTICIYLESDQSSGSDPDKNYWVRYRMAVVNQKSPAKTVWKESSICTKTWNNSVL
QFMKVSDMLEADAGFLVRDTVVFVCEILDCCPWFEFSDLEVLASEDDQDALSTDPDELID
SEDSEGISGDEEDIFRNLLARAGFHLTYGDNPSQPQVTLREKLLMDAGAIAGFLTGLRVY
LDDPAKVKRLLLPTKLSCCNDGKKEVMRTDESSPCLMNLLMGVKVLQQAIVDLLLDIMVE
CCQPSEGKSGEDSSDISTKTFADNNGAISPSESGSENAAVESLRIVHERLDSGVDENTIY
AVQSSDMNGADVLKKTVPGQPICPPETSAGSHAIDNGFTRAPKTKWPEQSEELLGLIVNS
LRALDGAVPQGCPEPRRRPQSAQKIALVLDKAPKHLQPDLVALVPKLVDHSEHPLAACAL
LDRLQKADGEPSLQLPVLGALSQLEFGSELWERVLYQAFKLLADSNHETLAAGLGYIFKA
ASHCQHLSQTVTVVRSKLKSLGSEVSDCVLDVLSKSINSSIDVADAILRDIDSNFELGDG
CLAAPSGLFLCNDMVNEQILRAGCHFSDIFVLIEMLSIPSFAVEAAQAFERGVAQGAIMD
QWLAMVLERRHVQRLSNSSRFIVESSQYKDLVEEGKSNDSLPFQGFDFTPMLGLAETMAL
SRNPRVQGFVKILYSLLFRIYTDEGYRVRMLKGLVDRATSSTDNSHVADLDLDILVFLVR
QEEGIARPVLSMMREVAELANVDRAALWHQLCASEDENIRIREERQVEVCNIVKEKDLLS
HRLSESEATSSRLKSDMKVEVDRISREKKELSEQIQEVESQLEWLRSERDDEIAKLSSEK
KVLQDRLYDAETQLSQLKSRKRDELKRVVKEKNALAERLKSAEAARKRFDEELKRYATET
VTSKEVRQSLEDEVQRLTQTVGQTEGEKREKEEQVARCEAYIDGMEAKLHACQQYIHTLE
SSLQEEMSRHAPLYGAGLEALSMKELETLSRIHQEGLRQIHALQQQKGSTGGNPLVIPHT
HPHSHGLYPSAQPPMAMGLPPSLVPNGVGSHTNGHMNGAVGPWFNPT
Download sequence
Identical sequences A0A2G5D4R1
Aquca_027_00003.3|PACid:22045955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]