SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00048.1|PACid:22045517 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00048.1|PACid:22045517
Domain Number 1 Region: 151-512
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.33e-37
Family WD40-repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00048.1|PACid:22045517
Sequence length 550
Sequence
MMNNTSNSNGMISPSSTSTNTQSQQGLKTYFKTPEGRYKLQYEKTHPVGFLHYAQGKTVT
QVSIAHLKEKSAQAPTSSSSSSLSASSGVRLAAARLLGGGNGSRALSFVGGNGTSKTVVG
SSKIGSLGGLSSSNSLVNSNYDGKGTYLIFNVGDTVFISDLNSHDKDPIKSLHFSNSNPV
CHAFDPEAKDGHDLLIGLYSGDVYSVSLRQQLQDFGKKLVGAQHYNKDGSVNNSRCTSIA
WVPEGDGTFVVAHADGNLYVYEKNKDGTGDSSFPIIKDQTQFSVSHTRSSKSNPIARWHI
CQGSINSIAFSTDGTYLATVGRDGYLRVFDYSKEQLICGGKSYYGAVLCCAWSMDGKYIL
AGGEDDLVQVWSMDDRKVVAWGEGHGSWVSGVAFDSFWSSPTSDDTGENVMYRFGSVGQD
TQLLLWDLVMDELVVPLRRPPGGSPTFSTGSQSSHWDSICPIGTLQPAPSMRDVPKLSPL
VVHRVHSEPLSGLIITQESVLTVCREGHVKIWMRPGYGESQSSTSETSLSTNSKDKPPLS
AKVGSSSYKH
Download sequence
Identical sequences A0A2G5D4Y1
Aquca_027_00048.1|PACid:22045517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]