SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00048.2|PACid:22045518 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00048.2|PACid:22045518
Domain Number 1 Region: 150-511
Classification Level Classification E-value
Superfamily WD40 repeat-like 7e-37
Family WD40-repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00048.2|PACid:22045518
Sequence length 548
Sequence
MMNNTSNSNGMISPSSTSTNTQSQQGLKTYFKTPEGRYKLQYEKTHPVGFLHYAQGKTVT
QVSIAHLKEKSAQAPTSSSSSSLSASSGVRLAAARLLGGGNGSRALSFVGGNGTSKTVVG
SSKIGSLGGLSSSNSLVNSNYDGKGTYLIFNVGDTVFISDLNSHDKDPIKSLHFSNSNPV
CHAFDPEAKDGHDLLIGLYSGDVYSVSLRQQLQDFGKKLVGAQHYNKDGSVNNSRCTSIA
WVPEGDGTFVVAHADGNLYVYEKDGTGDSSFPIIKDQTQFSVSHTRSSKSNPIARWHICQ
GSINSIAFSTDGTYLATVGRDGYLRVFDYSKEQLICGGKSYYGAVLCCAWSMDGKYILAG
GEDDLVQVWSMDDRKVVAWGEGHGSWVSGVAFDSFWSSPTSDDTGENVMYRFGSVGQDTQ
LLLWDLVMDELVVPLRRPPGGSPTFSTGSQSSHWDSICPIGTLQPAPSMRDVPKLSPLVV
HRVHSEPLSGLIITQESVLTVCREGHVKIWMRPGYGESQSSTSETSLSTNSKDKPPLSAK
VGSSSYKH
Download sequence
Identical sequences A0A2G5D4W6
Aquca_027_00048.2|PACid:22045518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]