SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00144.2|PACid:22046003 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00144.2|PACid:22046003
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.2e-21
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0019
Further Details:      
 
Domain Number 2 Region: 79-142
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000942
Family Cold shock DNA-binding domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00144.2|PACid:22046003
Sequence length 164
Sequence
MFYLSKIEHTLRLPPHLLDRDLDQAIKGELETLFVDKVIAKLGLCVSVYDITNISGGFIF
PGDGASTFTAEFRLIMFRPFVGEILSGEVEESDANGLRLSLGFFKDIMLPVHLLPNPSKF
ADARWTWDYGGVELPIEKEEEVFHCYQILQFDGYGTLVLEKQEC
Download sequence
Identical sequences A0A2G5D5F6
Aquca_027_00144.2|PACid:22046003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]