SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00221.1|PACid:22045458 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00221.1|PACid:22045458
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 4.06e-16
Family Ribosomal protein L29 (L29p) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00221.1|PACid:22045458
Sequence length 123
Sequence
MARIKVHELRDQSKPDLLKQLKELKDELALLRVAKVTGGAPNKLSKIKVVRTGIAQVLTV
ISQKQKQALRDVYKKKKLLPLDLRPKKTRAIRRRLTNHQLSLKTDREKKKEMYFPMRKYA
IKV
Download sequence
Identical sequences A0A2G5D5S2
Aquca_027_00221.1|PACid:22045458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]