SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00347.1|PACid:22045978 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00347.1|PACid:22045978
Domain Number 1 Region: 480-757
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-59
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 771-841
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-23
Family U-box 0.0015
Further Details:      
 
Weak hits

Sequence:  Aquca_027_00347.1|PACid:22045978
Domain Number - Region: 56-165
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000251
Family Universal stress protein-like 0.067
Further Details:      
 
Domain Number - Region: 352-400
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.011
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00347.1|PACid:22045978
Sequence length 843
Sequence
MEQLNNTSGSPPLPFQPVGNYFSKLPSFNLGFQQRRKIPEISEENDDDKVYVAVGKSIEK
SIDLLRWTFQRFGTQEIVLLHVHQPSSTIPTLLGKLPLSHANEEMVSAHQREEKERCKEL
LFNYLNICSKAKVKATIVTIESGQIQKGIVELVNMHASKKLVMGALLDINCMKVTNSTTK
ADYVSKFAPPFCKIWFVNKGKYVWTREAYADLGLYKPMHRPAERGREEWLRSNPSCRHKN
EHTGNPTYLRSDFYPNSAGVINWLQGDGDHVGVALSADESSFLNGSLQSLTRPNSSTPAS
GFTSVEIKVLSQLDSKLKEEDYYNQILEARTDAVSRNNIAFTELLKRKKLESEASEANNK
VKAFEAAYADEVQLRKEVEDTVANIQQEKEQVLKQIEDFSREWQTTKRIVPVLESRCSEA
NCCQNEASRELELIQMSLTTLQHETKNMRRQKEQAMQHREWWRNHLQLGVSSDGDFGFIN
TSAEYKHFSLFDLQIATCNFSESFLIGQGSYGCVYKGEISDRSVAIKKLNPFNMQGTPEF
QQEVEVLSKLKHARLVTLIGACPEALSLVYEYLPNGSIDDHLFRKTNNPLTWEKRTHIVA
DMSSALLYLHSREPRKIIHGNLKPKNILLDSEFNCKIGDFMIGQLVPKKTARCPSFRGIT
EMESAFPYIDPELQTFQDLTPKSDIYAFGVIMLQLLTGRSPMGLASKVRRAVLCGNLTSI
LDSSAGEWPTFVARRLVELGLQCCEFNGRDRPELKPALVKGLEKLHLAEGQPVPSFFLCP
ILQELMYDPHVAADGFTYEGEAIRGWLTGGRGTSPMTNLTLSHFSLTPNHALRSAIQDWL
CHC
Download sequence
Identical sequences A0A2G5D6G8
Aquca_027_00347.1|PACid:22045978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]