SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00347.2|PACid:22045979 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00347.2|PACid:22045979
Domain Number 1 Region: 309-586
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.46e-59
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 600-670
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-23
Family U-box 0.0015
Further Details:      
 
Weak hits

Sequence:  Aquca_027_00347.2|PACid:22045979
Domain Number - Region: 181-230
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0235
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00347.2|PACid:22045979
Sequence length 672
Sequence
MKVTNSTTKADYVSKFAPPFCKIWFVNKGKYVWTREAYADLGLYKPMHRPAERGREEWLR
SNPSCRHKNEHTGNPTYLRSDFYPNSAGVINWLQGDGDHVGVALSADESSFLNGSLQSLT
RPNSSTPASGFTSVEIKVLSQLDSKLKEEDYYNQILEARTDAVSRNNIAFTELLKRKKLE
SEASEANNKVKAFEAAYADEVQLRKEVEDTVANIQQEKEQVLKQIEDFSREWQTTKRIVP
VLESRCSEANCCQNEASRELELIQMSLTTLQHETKNMRRQKEQAMQHREWWRNHLQLGVS
SDGDFGFINTSAEYKHFSLFDLQIATCNFSESFLIGQGSYGCVYKGEISDRSVAIKKLNP
FNMQGTPEFQQEVEVLSKLKHARLVTLIGACPEALSLVYEYLPNGSIDDHLFRKTNNPLT
WEKRTHIVADMSSALLYLHSREPRKIIHGNLKPKNILLDSEFNCKIGDFMIGQLVPKKTA
RCPSFRGITEMESAFPYIDPELQTFQDLTPKSDIYAFGVIMLQLLTGRSPMGLASKVRRA
VLCGNLTSILDSSAGEWPTFVARRLVELGLQCCEFNGRDRPELKPALVKGLEKLHLAEGQ
PVPSFFLCPILQELMYDPHVAADGFTYEGEAIRGWLTGGRGTSPMTNLTLSHFSLTPNHA
LRSAIQDWLCHC
Download sequence
Identical sequences A0A2G5D6F9
Aquca_027_00347.2|PACid:22045979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]