SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00347.3|PACid:22045980 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00347.3|PACid:22045980
Domain Number 1 Region: 282-559
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-59
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 573-643
Classification Level Classification E-value
Superfamily RING/U-box 9.71e-24
Family U-box 0.0015
Further Details:      
 
Weak hits

Sequence:  Aquca_027_00347.3|PACid:22045980
Domain Number - Region: 158-202
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00347.3|PACid:22045980
Sequence length 645
Sequence
MKVTNSTTKADYVSKFAPPFCKIWFVNKGKYVWTREAYADLGLYKPMHRPAERGREEWLR
SNPSCRHKNEHTGNPTYLRSDFYPNSAGVINWLQGDGDHVGVALSADESSFLNGSLQSLT
RPNSSTPASGFTSVEIKVLSQLDSKLKEEDYYNQILEARTDAVKAFEAAYADEVQLRKEV
EDTVANIQQEKEQVLKQIEDFSREWQTTKRIVPVLESRCSEANCCQNEASRELELIQMSL
TTLQHETKNMRRQKEQAMQHREWWRNHLQLGVSSDGDFGFINTSAEYKHFSLFDLQIATC
NFSESFLIGQGSYGCVYKGEISDRSVAIKKLNPFNMQGTPEFQQEVEVLSKLKHARLVTL
IGACPEALSLVYEYLPNGSIDDHLFRKTNNPLTWEKRTHIVADMSSALLYLHSREPRKII
HGNLKPKNILLDSEFNCKIGDFMIGQLVPKKTARCPSFRGITEMESAFPYIDPELQTFQD
LTPKSDIYAFGVIMLQLLTGRSPMGLASKVRRAVLCGNLTSILDSSAGEWPTFVARRLVE
LGLQCCEFNGRDRPELKPALVKGLEKLHLAEGQPVPSFFLCPILQELMYDPHVAADGFTY
EGEAIRGWLTGGRGTSPMTNLTLSHFSLTPNHALRSAIQDWLCHC
Download sequence
Identical sequences A0A2G5D6G6
Aquca_027_00347.3|PACid:22045980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]