SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_028_00118.2|PACid:22038929 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_028_00118.2|PACid:22038929
Domain Number 1 Region: 5-319
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 5.01e-74
Family Catechol oxidase 0.000000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_028_00118.2|PACid:22038929
Sequence length 489
Sequence
MPVYCCPPNIESDEQIIDFEFPDPSEQLRIRKRAHMRDSDYIAKYASALSIMKSLPYDDP
RSFARQADVHCIYCTGSYNKKHSNEFLNVHRSWFFFPWHRMYIYFHERILASLIDDDTFS
LSFWNWDTPAGMVMPDMYFQEPFLDTERSDKHIHRPRVVNLDYNLVEINRTSEEQISHNL
AVMYHQVVSGAKKMELFMGCIYKSGINGSCDGAGTVEQAPHDSLHGWVGKESNRYLEHMG
VFYAAARDPIFFAHHANLDRIWNVWEELRNNEPEIVDPDWLDSYFFFHNEKSQLVRIKVR
DVLNMTKLRYGYEKVDNLWLNARPKPSMDPTMARHALNTKHNGYLTAQSNDFRPNGRTLD
STITAKVQRPKNQRKAENEEEILVVYGIDTKEDVYIKFDVFVNAVDAITIGPESREFAGT
YVNLPRGVTRVLNDGDVETKSKSTLKLGISELLDDLQANEEDSIWVTLVPRGGTGVHTSV
EGIRIEYMA
Download sequence
Identical sequences A0A2G5D408
Aquca_028_00118.2|PACid:22038929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]