SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_028_00264.1|PACid:22038582 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_028_00264.1|PACid:22038582
Domain Number 1 Region: 2-276
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.13e-45
Family WD40-repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_028_00264.1|PACid:22038582
Sequence length 277
Sequence
MDGVMYVWNVWSRGQKKVRVFNYHSAAIKCLRWSQDGLSLLSCGYDCSSMLVDVETGIQR
QTFKEDQVVGVLKFHPGNFNLFLTGGSKGLLSLWDVRIGRVVQEYIRNLGPILDIDFSVD
AKQFVSSSDISKSNASENSIIVWDVSRQIPLSNQVYVEAYTCPCVKYHPSDPFFVAQSNG
NYIAIFSSSPPFRLDKYKRYDNHGVSGFPIKCDFSLDGEKLASGSSDGCIYIYNFRSSEL
LRKIKAYEQACVDVAFHPRIPNVIASCSWSGEVSVFE
Download sequence
Identical sequences A0A2G5D4J2
Aquca_028_00264.1|PACid:22038582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]