SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_028_00273.2|PACid:22038661 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_028_00273.2|PACid:22038661
Domain Number 1 Region: 465-646
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-57
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 61-170
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-25
Family alpha-D-mannose-specific plant lectins 0.0073
Further Details:      
 
Weak hits

Sequence:  Aquca_028_00273.2|PACid:22038661
Domain Number - Region: 334-395
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.012
Family Anti-platelet protein 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_028_00273.2|PACid:22038661
Sequence length 646
Sequence
NLLMYQKILIEAYTLTPSQSILDGQTLISKGGKFELGFFSPSNSINRYLGIWYKTIPVQT
VVWVANRDTPINDTTGVLKIGTSGNIVIVNQTEGVIWSSKSSKAVENPILEFLELGNLVL
RDVKNEDPENYLWQSFDYIGDTLLPGMKLGWNLKTGIERYMTTWKNFDDPSHGDFTYGID
HTGYLETSIRNGSHKIYRGGPWNGIRHSGATDLKPNSIFSYNVVHNADETYYMYQLVNQS
VILRLVLTQTRNEGHLQRYTWIEKTNTWVLLVSIPRDRCDDYALCGVYGTCDVTDVAVCQ
CLRGFQPKSPEDWSGTDWAQGCERETSLNCTEGDGFMQFTGVKLPETVGSMVNTSMNLEE
CRISCLKNCSCMAYSNSDVRGDGSGCIRWFTNLIDIRQLSDGGQDLYIRMAASELDSKAK
SKSKEPVVLIVSITCVIGVIVLGLASWFLWKKRSPKGSNEGDDLELPLYDLCTITVATDS
FSEENKLGEGGFGPVYKGKLKGGQEVAVKRLSKDSIQGINEFKNEVILISKLQHRNLVRL
LGCCIQGEEKMLVYEYMELKSLDSSIFDTAKRRLLDWRKRFDIILGIARGLLYLHHDSRL
RIIHRDLKASNILLDSEMVPKISDFGMARLFGGDQLTAKTKRVVGT
Download sequence
Identical sequences A0A2G5D4K5
Aquca_028_00273.2|PACid:22038661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]