SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_028_00277.1|PACid:22038941 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_028_00277.1|PACid:22038941
Domain Number 1 Region: 78-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-27
Family alpha-D-mannose-specific plant lectins 0.0064
Further Details:      
 
Domain Number 2 Region: 485-524
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000497
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 
Weak hits

Sequence:  Aquca_028_00277.1|PACid:22038941
Domain Number - Region: 352-424
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00432
Family Anti-platelet protein 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_028_00277.1|PACid:22038941
Sequence length 536
Sequence
MMGALSFLIFWFSVLTLFCQDINIAAYTLTPSQSILDGQTLLSQGEKFELGFFSPTNISK
NRYLGIWYNLNVVPVQTVVWVANRESPLKDTSGVLKIGASGNIVVVNQTEGVIWSSNVSK
TVDNPILEFLESGNLVLRDVNNSSSETYVWQSFDYPGNTLLPGMKVGWNSKTGLNRKMSS
WKNFDDPSYGDFTDEMANTGYYESFIRKGSRNIYRTGPWNGLGFSGAPDLKDNPIFTYEV
VRTADELYYMYQLVIKSVILRYVLTQTGSEGLLQRLTWVEKANKWVNLVSIPRDRCDDYG
LCGAYSTCDSTIVAVCQCLKKFKPKSPLDWSETDWSQGCERETSLNCTEGDGFIKYTGVK
FPDTTGTWFNTSMNLEECRVKCLQNCSCMAYANTDISGDGSGCIMWFTDLTDIRQMNNAG
QDLYIRMAASEIDLHANSKMKKRVIIIVVFTIVSGMIVVVLGTWYFWKKRSLKGGHSEKD
DLELPLYQLVTLASATNNFSEENKLGEGGFGPVYRVNFDITGSVHNAKYSLHCDGK
Download sequence
Identical sequences A0A2G5D4L1
Aquca_028_00277.1|PACid:22038941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]