SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_028_00278.1|PACid:22038596 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_028_00278.1|PACid:22038596
Domain Number 1 Region: 390-701
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-81
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 24-133
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.93e-27
Family alpha-D-mannose-specific plant lectins 0.0083
Further Details:      
 
Weak hits

Sequence:  Aquca_028_00278.1|PACid:22038596
Domain Number - Region: 297-370
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00033
Family Pan module (APPLE domain) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_028_00278.1|PACid:22038596
Sequence length 723
Sequence
PTNTSNNRYLGIWYNLNAVPLRTVVWVANRESPLNDTSGVLKIGATGKIVVVNQTEGVIW
SSNVSKTVDNPIIEFLESGNLVLRDVNNSNSEGYVWQSFDHPGDTLLPGMKLGWNSKTGV
NRMMSSWKNFDDPSYGDVTNEMAYTGYLESFIRKGSRKIYRSGPWNGLRFSGAADMRTNT
LFTYQVVRTEDELFYMYQLVNKSVILRYVVTQSGSEGHLQRMTWVEKTNSWVNLVSIPRD
RCDDYALCGAYSTCDSTNVAVCQCLQKFKPKSALDWSGTDWTQGCERETSLNCTEGDGFI
KYTGVKLPETTGTWFNTSMTLEECRVKCLKNCSCMAYANTNISGDGSGCIMWSTDLTDIR
QLNNAGQDLYIRMAASELGDHSEKEDLELPLYNLVTITNATNNFSEENKLGEGGFGPVYM
GKLEGGLEIAVKRLSKDSIQGVDEFKNEVLLISKLQHRNLVRLLGCCIQGDEKMLVYEYM
ENKSLHSFIFDVTKSKLLDWQNRFDIILGIARGLLYLHHDSRLRIIHRDLKASNILLDSE
MVPKISDFGMARIFRGDQLEASTKRVVGTHGYMSPEYAVDGQFSVKSDVFSYGVLVLEII
SGKKNRGFWHPDHELNLLGHAWRLWNEDKCMELVDDSISNSASAQDIIRCIHVGLLCVQK
FSEQRPTMSSVLLMLSSETVVLPDPQRPGFYIERGPVNDHSSYSEKESCLSNDATITILL
EGR
Download sequence
Identical sequences A0A2G5D4L8
Aquca_028_00278.1|PACid:22038596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]