SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_028_00282.2|PACid:22038958 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_028_00282.2|PACid:22038958
Domain Number 1 Region: 507-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-74
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 77-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-27
Family alpha-D-mannose-specific plant lectins 0.0059
Further Details:      
 
Weak hits

Sequence:  Aquca_028_00282.2|PACid:22038958
Domain Number - Region: 347-408
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0357
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_028_00282.2|PACid:22038958
Sequence length 772
Sequence
MAAGLYIFIFYSYILNLLYQEIPIAAYTLTPSQSIIDGQILISQGETFELGFFSPSNSKF
RYVGIWYNTKTIPVQTVVWVANRDSPLLDTSGVLKVDTTGNVVIEDGRRKVIWSSNSSKA
VESPIVEFLDSGNLVLRDKKNGDSENYMWQSFDYLCDTLLPHMKLGRDLKTGHDRFMSSW
KSSDDPSYGDFTYGTYRTGLPELAIRNRSKMYYRSGPWNGIRFSGSPDLKGNSIFTYEVI
QNAEEMYFRFQLVNKSVVSRFVLRQTSLHGLTWVDQTNSWFLQITIPRDPCDAYSLCGAY
SSCDSNNVPVCRCLRGFKPKSAQDWEEMDWSQGCKHNTSVNCSKGEGFNRISGVKLPDTT
GSWFNMTMNLDECRVKCLKNCSCMAYTNADIRGSGSGCVMWFTDLVDIRQFSNDGQDFYI
RMAPSELENDVMSDTKSYSRTKKRVVLTVTVAVLVSIFLLGLGAYIFRKKQMKTITRKLP
TEVNKEKSQEVPLFDTVKPITREYSSENKDDLEVLLYDFDTIATATNNFSNLNKLGEGGF
GCVYKGTLKDGQQIAVKRLSKTSGQGVEEFKNEVVLIAKLQHRNLVGLYGCCVEGEEKML
VYEYMLNKSLDYHLFDKANNLLIDWQKRFNIIVGVSRGLLYLHQDSKYRIVHRDLKASNV
LLDGEMNPKISDFGMARIFGGDQTEGETNRVVGTYGYMSPEYAMDGHFSAKSDVFSFGVL
VLEIISGKKNRGFYCSSKQFNLLSYVSTYLWFICFTYTISIIFCPHLCIICG
Download sequence
Identical sequences A0A2G5D4M8
Aquca_028_00282.2|PACid:22038958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]