SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_029_00071.4|PACid:22026102 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_029_00071.4|PACid:22026102
Domain Number 1 Region: 357-603
Classification Level Classification E-value
Superfamily BEACH domain 2.35e-75
Family BEACH domain 0.000045
Further Details:      
 
Domain Number 2 Region: 223-315
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.54e-19
Family Protein kinases, catalytic subunit 0.0081
Further Details:      
 
Domain Number 3 Region: 721-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000166
Family Protein kinases, catalytic subunit 0.0042
Further Details:      
 
Weak hits

Sequence:  Aquca_029_00071.4|PACid:22026102
Domain Number - Region: 827-1018,1074-1179
Classification Level Classification E-value
Superfamily ARM repeat 0.000134
Family HEAT repeat 0.064
Further Details:      
 
Domain Number - Region: 1301-1355
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00419
Family WD40-repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_029_00071.4|PACid:22026102
Sequence length 1357
Sequence
MEMDINSHHHQTETCFECLEHEIHKDFSEKLIFSYGIFDSSSSGFPFGSRAIVQVPTSTT
TATQFLLVRLPFHQHHCLTKYVDGFSLEDVESDNEQRKDGMKSYEKYKNQGKDVGVVSYS
STIELHCLFEHGKTICQGGEGINSFSISYSGKFSCVRTITALAPVAYVGKGSYSTIEKLS
EKLLSESIEDHVVSSLIHLFEGKPTGCDAENFLNLVGIPSFDENNIPGCLRHPNIAPVLG
MLKTAGHINVVLPKAPYTLENILYYCPSTLQTEWHIKLLLYQLLSAVAYLHSLGIAHGDV
CPSNVMLTSSCWLWLNVFEKPHINCKQNVMHEDDSHVIPPSSLSCPTNNCPFQAVYADLK
LSPVIDWHSNFKRWWRGELSNYEYLLVLNRLAGRRWGDHTFHTVMPWVVDFSVKPDENSD
TGWRDLRKSKWRLAKGDEQLDFTYSTSEVPHHVSDECLSELAVCSYKARRLPLSVLRSAV
RSVYEPNEYPSNMQRLYQWTPDECIPEFYHDPRIFTSLHSGMSDLAVPPWASSTEEFIKL
HRDALESNRVSKQIHHWIDITFGYKMSGQDAVVAKNVMLPSSEPSIPRSAGRRQLFTRPH
PMRQVKHIESQESILLGAADLQDLEDAASFCEDACHLSPIYYYDQGNTVNKAPFVNQQLS
GYSETEISNFPASGKYPFGLSDIRSSNLIEYFEVEDNGSLGFQELCLWKQKSSDLHPLSK
DIAEDIFAIGCILAELHLKRPLFNSTSLAAYVGSGMLPGLMHDLPSDVALLVEACIQREW
WRRPSAKYILESPYFTATVRSSYMFLAPLHLLVEVEHQLQYAAKLARQGALKAMGTYTAE
MCAPYCLELLVPPLSDTKAEWAYILLKEFLKCLKPPAIKELVLPSIQKILQAVDYSHLKV
SLLQDSFMCEIWTKVGKQAYLQKIHPLVIANLSVSPHKNSASAASVLLMGSCEELGIPVT
VHQTILPLIHSFGKGLCADGIDVLVRIGSLLGDTFIVKHILPLLRNIVLSCIDVSNTDKS
EPIQSWNALAVIDSLITLDGLVAALPSEVVIKELVQDRSCLHVKVLMQKNLELSVLQVAA
TTLIEVCQRIGPDFTSLHVLPQLKELFDEFAFSKETINNTSSSGRTLKVASSRFDAVQVE
SRMDLVLLLYPSFASLLGIEKLRQCCATWLLLEQILQRSYNWKWDYSGEVPKFFSENISS
QRPILSKISTSDYSPAKMLLTGVGWSVPQSQGARGAKNWTYKQSNDHQLVQVNKHVLTSN
HEKREPWIWYPSPAASWDGPDFLARSGGSKDELPWKIRASIIHSARAHPGALRAVAVCHD
ECTVFTGGVGPGFKGTVQKWELQRMECVSGYYGHEEV
Download sequence
Identical sequences A0A2G5D380
Aquca_029_00071.4|PACid:22026102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]