SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00152.2|PACid:22035640 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00152.2|PACid:22035640
Domain Number 1 Region: 108-216
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-28
Family B3 DNA binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  Aquca_030_00152.2|PACid:22035640
Domain Number - Region: 606-676
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00314
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00152.2|PACid:22035640
Sequence length 689
Sequence
MDETEKCLDSQLWHACAGGMVHMPLVNSKVYYFPQGQAEHTHGAVDFGNSSRIPALILCR
VAVVNFKADPETDEVYAKIRLVPLRSNEPDYYDDNDEIADTNGSEAPDKLASFAKTLTQS
DANNGGGFSVPRYCAETIFPRLDYSADPPVQTVLAKDVHGEIWKFRHIYRGTPRRHLLTT
GWSTFVNQKKLIAGDSIVFLRTENGDLCVGIRRAKRGLGGGPESPSGWNPTIGNGGSPYG
GFSVFLREDDTRLMRNSNGGNPNFGGSLRGRGKVRPESVIEAATLASKGQPFEVVYYPRA
STPEFCVKASSVRASMRIKWSSGMRFKMAFETEDSSRISWFMGTISSAQVADPIRWPNSP
WRFLEVTWDEPDLLQNVKRVSPWLVELVSNMPTIHMSPFSPPRKKLRLPQHPDFPLDGQL
PMPSFSSNTLGSSSPLCCLSDNTPAGIQGARHAQFGISLSDLHLNKLQSGLFPACFQRFD
HVAPPSRIPNGLMMGNPNNTESVSCLLTIGNSNQSSKKSDEAKTPQFVLFGQPILTEQQI
SLSFSAEAVSPVLNGSGSSDGNSDKTAKVSDDSDSAPPPRSGQGNPVFPQYKDHRMTELD
LETGHCKVFMESEDVGRTLDLSVLGSYEELYRKLANMFGVERSETLSHVLYKDATGAVKH
TGDEPFSEFVKAAKRLTVLTDSGKENVGR
Download sequence
Identical sequences A0A2G5D1F6
Aquca_030_00152.2|PACid:22035640 Aquca_030_00152.3|PACid:22035641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]