SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00233.1|PACid:22035944 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_030_00233.1|PACid:22035944
Domain Number - Region: 57-94
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00053
Family Ribosomal protein S4 0.037
Further Details:      
 
Domain Number - Region: 174-201
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0582
Family Ribosomal proteins L24p and L21e 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00233.1|PACid:22035944
Sequence length 264
Sequence
MARGLKKHLKRVNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRERLKYGLTGHE
VVSILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRMHAIKDEEAK
VKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLESNKILDFIKFDVGNV
VMVTGGSNRGRVGVIKNREKHKGTFETIHLQDSTGHPFATRLGNVFTIGKGTKPWVSLPK
GKGIKLTIIEEAKKRQAAQGAATA
Download sequence
Identical sequences A0A2G5D1Y9
Aquca_030_00233.1|PACid:22035944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]