SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00251.1|PACid:22036124 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00251.1|PACid:22036124
Domain Number 1 Region: 298-410
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-28
Family LexA repressor, N-terminal DNA-binding domain 0.056
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000504
Family VPS36 N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00251.1|PACid:22036124
Sequence length 435
Sequence
MAGKWFPAAQLTSSGRPVFVTGEVESTLLSSVDLECEENSHVPLLKSGVLILTTHRLLWI
NETNTSSSAAAVAIPLGTVTHIFPPKKSMKHMFASPRVRFQVSTSVDGMVIENGQKSMVL
TLVLRGSKSDLDSFYSRFWEVWRGRSWEVLSLASSESTSMEGSSVVKTTVVGVSGILRRE
QEMWESTDKTLQDAFQDLNALMSKAKEMVMLAEKMRLKLLSGPASEPKANDEEMTSKQEM
QDWLLSVGIASPVTKESAGALYHQQLSRQLADFVKLPLERAGGMIALIDIYCLFNRARGT
ELISPEDLLRACAIWEKFDVPVMLRKFDSGVMVIQNKSHSDEEVFGRIKSLVSKPDALRT
GISPSDAAMTLGIAPAMAKEHLLTAESKGLLCRDISPEGFRFFINLFKEIDLNDIYSVKD
HGIYRSWISIGSASG
Download sequence
Identical sequences A0A2G5D1Z6
Aquca_030_00251.1|PACid:22036124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]