SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00265.1|PACid:22036007 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00265.1|PACid:22036007
Domain Number 1 Region: 183-272
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0000000000353
Family Biotinyl/lipoyl-carrier proteins and domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00265.1|PACid:22036007
Sequence length 283
Sequence
MISSGGIANLAITDKLGGTSYTQFSNLEFTRSRSRNVCPLYGVRAWTRKNALSFTGVKLS
KRSANPSAVSCTPSSDKTASNLEVGLEAKKPVAIESQIIPTSFEVESLVSEICETASIAE
FELKFNGFRLYVTRNLAGKTTHSPPSTPPSDNTSIVVQAPASNGSVSGHSLAISKPTPSG
ENRTMLEKATDEGLVILNSPRVGIFRRSRTIKEKRLPPPCQENQSVKEGQAVCYIEQLGG
EIPVETNVAGEVVKILKEDGDSVGYGDALMKILPSFPGIKKLQ
Download sequence
Identical sequences A0A2G5D245
Aquca_030_00265.1|PACid:22036007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]