SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00279.2|PACid:22035837 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_030_00279.2|PACid:22035837
Domain Number - Region: 682-789
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00178
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number - Region: 74-121
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0492
Family Troponin I 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00279.2|PACid:22035837
Sequence length 2076
Sequence
MPLFISDEEFERCSHDSSVVAEKADSFIKDLQRQLETVKAQEDAASITSEQTWSLIEQKY
ISLSSDFAKLESENAQLNTCIEQLTSELAEVRSEKHQLHLQVIGKDGEIERLSAEVSELH
KSKRQLLDLVERKDSEINEKNVTIKSYLDKIVNLTDDAALKQAQLHDREAELARSQATCA
RLSQEKELIERHNVWLNEELTAKVGDLIRVRKTHNELEADMSSKLADVEKQFTECSSSLR
WNKERVKELDSKLVSLQEEFCSSKDSAAANEECFSAEISTVTKLVELYKESSEEWSRKAG
ELEGVIKALEMHLSQVESDYKEKLEKEVSARKLHEKEAAELKEKLDKCEAEIENYRKGNE
LSLLPISSFTEETWTYNTAAHDMSDRVLVPKIPVGVSGTALAASLLRDGWSLAKMYEKYQ
EAVDALRHESMGRKQSQAILERVLYEIEEKAEVILDERAEHERMVEAYSAINQKLQQSTS
EQAKLEGTIQDLKADLRRREREYVVAEKEIIDLQKQVTFLLKECRDIQLRCGSASDVYPD
EGVTTISVEMKDVSDTERVISERLLTFKDINELVEQNVKLRSLLRSLSDQNEKRDTELRE
IFEIELKKQAEEAASKVAAVLDRAEEQGKMIESLHSSVAMYKRLYEEELKLRASFPDSSE
EVPDLGRKTHMLLLEDSQGASKKAQEQVLERAKGLEEQLDRSRNETVSLRLERDKMSMEL
NFARERLQSFMKEFEHQRDEMNGVLARNVEFSQLVVDYQRKVRENSDSLHAAEDLSRKLT
VEASLLKHEKELLVNSEKRACDEVRSLSERVHRLQATLDTIHSAEEVREEARAIEKRKQE
EYMKQVERDWAQAKKELQEERDNVRTLTLDRDLTIKKAMRQVEELGNQLSDALRAVASAE
SRAAVAEARCSDLEAKFKAPQDKVVDVGCDPSTSLATEVSMDMPKVKEEMEKLKLEALAN
KDHMLQYKNIAQVNEAALKQIESAHERFKAEADKMKKSLEAEISSLRERLSELESDNVLK
IKETASVVAGKEEALSSALAEVNSLKEECSVKISQIMGMEVQISSLKKDLEEEHQRWRTA
QNNYERQVILQSETIQELTKTSQALGLLQDEVSKLRKLSDTLKSENGILKDKLTSEKSVL
GKLKDEAERKYNEVNEQNKILHTRLEALHIKLAEKEKHSAGTSGSSTDSQGDADLQTVVS
YLRRSKEIAETEISLLKQEKLRLQSQLESALKASETAHGQLHAERANSRALLFSDEDFKA
LQIQVREMNLLRESNLQLREENKHNFEECQKLRELARAERVEMECLRKMMSEKTIEVDSC
RKEIEMQNIERGNLENRIAELLGTIKNIDLEEYHRLKDDYQQMQGKFRVIEAELDETRKL
VSEKQISVTGLEQELAKSQVELNKREARIKEIEAAHKSDMEKQRKGAFQIKKKHDALAKE
KEVLNKEKQALSKQLEDSRQGKRPLGDAISDQTIKEKEKEKDTRIQMLERTLERERDNSR
KEREEYQKQKEEYQKQKEEYQKQKEEYQKQKEERLKVQRAVEKLYKKMEQEKEKLLSELE
KHKQARESLSEVDQSPETALDNQTAAYLLTVQNLEEAMDPILTDEIGARVPPLETSTMDA
SSTAARQVPAQALPITGSGVGPSQDKTTDEREKRSNLPKPQNESRKIARRLIRPHLRPQE
PSGDTEMSEAQGLLTAEGKKDLMFPIPQSSARKRSASLPEPEIREESQSQPDTNPIAVQP
VSKKSRSEAPQDDVVSEESDPPKTLESSSNLDEAFDAAGDQPLTANEMAVPAEKDEVCAT
TELDEESNEGIIDVVSNNEAQSNELLDASEELFDNVRDTEEGFGDELDGEEQDPLQSTVE
IESDREEGEVGPDALDEHDGGDLSCMMSSLETGEFQHVPDVPLSAVDEEHVSTADEVNET
MTSTVVDEKNDTVEGAEDTPENSEKSTNDNDKENVETQKSPKASFSGVGSSPSPSNPSDP
TVSDRGSHIAPPVMEEEESPAERPTTINLNERARERAQLRVQGVVRASPPANTRSSRAAG
ARLNARGARGGRGSRSSRGGTGGGGNRGQKSEEGQG
Download sequence
Identical sequences A0A2G5D263
Aquca_030_00279.2|PACid:22035837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]