SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00339.2|PACid:22035878 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00339.2|PACid:22035878
Domain Number 1 Region: 211-312
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0000000000366
Family FtsH protease domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00339.2|PACid:22035878
Sequence length 331
Sequence
MSLCISSLFHSTTLHSNSKFYHKSKRKSIKIKALREWKEYDEAVKKKDLAKALKFLKSIE
TPLPIQQPISSYSEESNGLTFLQPMRDWEVLDACLNADDMKLVGNAYKFLQDRGFLPSFG
KCRNIVLEGPREVTPTVLKSSTGLEASKLSPKKWGLSGSTSAVLVAFLGGTSYLLSQGID
IRPNLAAILGLAFMDSIFLGGSCLAQISSFWPPYRRRILVHEAGHLVTAYLMGCPIRGVI
LDPIVAMQMGIQGQAGIQFWDEKLESELAEGKLSSASFDRYCMVLFAGIAAEALIYGEAE
GGENDENLFRSICLLLQPPLSIAEVVSSAVV
Download sequence
Identical sequences A0A2G5D2K2
Aquca_030_00339.2|PACid:22035878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]