SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00341.1|PACid:22036154 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00341.1|PACid:22036154
Domain Number 1 Region: 156-376,405-449
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.45e-37
Family Phospholipase D 0.066
Further Details:      
 
Domain Number 2 Region: 482-609,655-743
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.31e-30
Family Phospholipase D 0.076
Further Details:      
 
Domain Number 3 Region: 6-154
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.85e-21
Family PLC-like (P variant) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00341.1|PACid:22036154
Sequence length 813
Sequence
MAMILLHGTLHVTVFEADSITNPDRATGGAPKFFRKLVENIEETVGVGKGTSKLYATIDL
EKARVGRTRMIENEPVAPRWYESFHIYCAHAASNVIFTVKDDNPIGATLIGRAYMPVQEI
LDGEEVDRWLEILDEDKNPVTGGAKIHVKLQFFDVTRDRNWDRGIRSQKFPGVPYTFFTQ
RHGCKVTLYQDAHVPENFIPKIPLSDGKSYEPHRCWEDIFDAISNARHMIYITGWSVYTE
ISLVRDSRRPKPGGDITLGELLKKKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETA
NYFQGSDVNCVLCPRNPDNGGSIVQDLQISTMFTHHQKIVVVDGEMPSGGSEQRRIVSFV
GGIDLCDGRYDTAFHSLFRTLDTAHHDDFHQPNFPDASIAKGGPREPWHDIHCRLEGPIA
WDVLYNFEQRWRKQGGKDLLVQIRDLADTIIPPSPVTFQEDRETWNVQLFRSIDGGAAFG
FPETPEDAARAGLVSGKDNIIDRSIQDAYINAIRRAKNFIYIENQYFLGSSFSWKQDDIK
GEDVGCLHLVPKELSLKIVSKIEAGEKFTVYVVVPMWPEGIPESGSVQAILDWQRRTMEM
MYTDIIQALEAKGLQENPKEYLTFFCLGNREVKKSGEYTPTEQPEPDTDYSRAQAARRFM
IYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHIATGQPARGQIHGFRM
ALWYEHLGMLDDTFIQPESTECVQKVNKIADKYWDLYSSETLEQDLPGHLLTYPVGVASD
GVVTELPGTEFFPDTKARILGTKSDYLPPILTT
Download sequence
Identical sequences A0A2G5D2J0
Aquca_030_00341.1|PACid:22036154 Aquca_030_00341.2|PACid:22036155 Aquca_030_00341.3|PACid:22036153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]