SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00362.1|PACid:22036183 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00362.1|PACid:22036183
Domain Number 1 Region: 26-151
Classification Level Classification E-value
Superfamily Single hybrid motif 3.25e-43
Family Biotinyl/lipoyl-carrier proteins and domains 0.00000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00362.1|PACid:22036183
Sequence length 155
Sequence
MASRLLASKAASYLRVSIFHRSFSSVVKDLKYAKSHEWAKVDGSSATIGITDHAQDHLGD
VVYVELPEVGAAVKKDFSFGAVESVKATSDINSPVSGKVIEVNEELHASPGLINGSPYEK
GWIIKVEMKDANENEVNSLMDSDRYTKFCEEEDTH
Download sequence
Identical sequences A0A2G5D2Q9
Aquca_030_00362.1|PACid:22036183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]