SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00402.1|PACid:22035692 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00402.1|PACid:22035692
Domain Number 1 Region: 63-161
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000118
Family B3 DNA binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00402.1|PACid:22035692
Sequence length 171
Sequence
MVVEEEELALDEILRQGAENLKYMSEKPVNMETEAFASLQEQIETQPLIPPVERLRKKVI
GPCYSWEKNLKKSDVDGGQRRLMLSSKDFAVPSVNQLLRDKDDVTKGVEVRVYDNYGEKY
KMEYKRWGTKAHVLHRGWNEFRKNHGLVEHKAITLWAFRRKGDQSLCFAII
Download sequence
Identical sequences A0A2G5D2X5
Aquca_030_00402.1|PACid:22035692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]