SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_031_00080.2|PACid:22050748 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_031_00080.2|PACid:22050748
Domain Number 1 Region: 211-405
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-30
Family BCR-homology GTPase activation domain (BH-domain) 0.002
Further Details:      
 
Domain Number 2 Region: 30-156
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-18
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Weak hits

Sequence:  Aquca_031_00080.2|PACid:22050748
Domain Number - Region: 609-681
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00654
Family Myosin rod fragments 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_031_00080.2|PACid:22050748
Sequence length 885
Sequence
MSVIDVRDVIQNKGMGSRNAEINQGDGGSSSAPPPAPSLDQPRSRAGNTVFKSGPLLISS
KGIGWTSWKKRWFILTRTSLVFFRSDPSVIPQKGSEVNLTLGGIDLNNSGSVVVKEDKKL
LTVLFPDGRDGRAFTLKAESSEDLHDWKTALENALAQAPSAALAMGQNGIFRNDPADTVE
GGFEKWSNRCPVKSLVVGRPILLALEDIDGTPSFLEKALTFIEQYGVKVEGILRQSADVD
LVNRRVREYEDGRNEFSSDEDAHLIADCVKHVIRGLPSSPVPASCCNALLEACRADRGGR
INAMRAAVADTFPEPNRRLLQRILKMMQIVASHKSENRMSSSAVSACMAPLLLRPLLEGD
CELENDFNMGGDGSVQLLQAAAAANHAQAIVITLLEEYDNIFGEFPLQDGSVSPELYTDS
EESGSEGDEPTDDDENLEDDDENLDDDEDSVVRHNLATDSEDEGASSGTISGSSYTGDDQ
YDNKGSEDSGSEFGSAEGGEVEATQMTSSGTQTSLSQNDSIQNNNNLQNKCNIHPEMATS
ECQESLEDDPPSTSPMLEEIDQSHSSFSTKSTDKINEAMPVARRPTVWGRTSARKNLSME
SVEYGNEDEVEIQKLELNKIDLQKKIVKEVKENKALHANLENRKKALQERRLALEQDVTE
LQGQLQKEKDLRATMEARLNKPLGRSSISPNIDNKTKAELEEISQAEEDVVNLKKKVADL
HLQLNQQSKNKYGSVCASCGQPQQREYHSEHQKNQEEDLDTTGAASLRDRSRNSEDGSSR
TEAGHVITEETHLFPKKQLAEKDQIEARTSSTSKKSSTKVELTSTQPLHLEQGTATTSTA
LSKLTTRLNFLKERRTQIVNELQNIENSRGSDSQLLAAPPRMHPR
Download sequence
Identical sequences A0A2G5D0N3
Aquca_031_00080.1|PACid:22050747 Aquca_031_00080.2|PACid:22050748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]