SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_032_00052.1|PACid:22057227 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_032_00052.1|PACid:22057227
Domain Number 1 Region: 72-120
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.000000562
Family FtsH protease domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_032_00052.1|PACid:22057227
Sequence length 124
Sequence
MVTTFGMHDIGPWNRIDSSAQSGYMIIRTPETQCQKGLAEDISSKWGYDHEWCHKLMLER
LVGLMLLLNNCEALHIQLTDSAYKIALSHIKNNCEAMDKIVEILLKETITGDEFRAILCE
WLPK
Download sequence
Identical sequences A0A2G5CZY5
Aquca_032_00052.1|PACid:22057227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]