SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_033_00091.1|PACid:22024575 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_033_00091.1|PACid:22024575
Domain Number 1 Region: 452-741
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-77
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 77-179
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-24
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  Aquca_033_00091.1|PACid:22024575
Domain Number - Region: 347-401
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00137
Family Pan module (APPLE domain) 0.047
Further Details:      
 
Domain Number - Region: 184-229
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0489
Family Ricin B-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_033_00091.1|PACid:22024575
Sequence length 812
Sequence
MAIRSKPWFYLSFVFILSCNTNLSIASDSITPGQSLSGNQTLISKGGIFELGFFKPGNSS
NNYYLGIWYKKISVLTVVWVANRNNPVKDPSSSKLAFLKDFGLVLRDQSGSRLWSSCLSS
PTLGVLLDSGNFVLKDRSDSPLWQSFNHPTETWLPGAKLGSNKYGYRNGLTSWRSSDDPR
AGTFLLQAASNRTNLVLRNVHNSSAYTYWTWSWNGQSFSLMDTSILKYVNFSFLSNGNVS
NFSYSVYDSSIPTRIAMDLFGRVQLLMWAEDSKRWDSIVLHIDICGSNSWKNGGYDCRCL
TGFEPRFPKEWISGSWSGGCVRKKKLQCPYQGKNKFFVMGSIKVANNSNNYVVESIGKCK
NLCLTTCSCTAYAYAYSSLCMIWSDDLFFHQQLKRNDIRRDLHVLVELTGSGNKVKEKIY
MVVGSIGAIILLGILLLIVRKCRRKNIKVASAGTQEDYLHSFKYMELHRATKNFSEQLGK
GSFGCVYRGTLPDSTAIAVKMLGCQLSGEKQFRAEVNTIGMIHHKNLIRLRGFCAEGTKR
LLVYDFMPNSSLNQYLFQKDFKTLAWKTRYDIALGIARGLAYLHEKCRDCIIHCDIKPEN
ILLDAEFNPKVADFGLAKLLGRDFSRVLTSMRGTRGYLAPEWLSGVAITTKADVYSFGMM
LFEIISGRRNLDMTDDDLIDYFPARVANKITNGEDVSGLLDPMLNGNAELEELVRVCRVA
CWCIQNDEKDRPSMGQIVQVLEGGLDASTPPIPSYLQQILDFPKYQDNSLCDGHVAVIKN
NSTSENESINSWTSSSLYGTMVGSPSRNNSLR
Download sequence
Identical sequences A0A2G5CZE9
Aquca_033_00091.1|PACid:22024575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]