SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_033_00103.1|PACid:22024573 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_033_00103.1|PACid:22024573
Domain Number 1 Region: 455-745
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-76
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 77-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-22
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 
Weak hits

Sequence:  Aquca_033_00103.1|PACid:22024573
Domain Number - Region: 349-405
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00255
Family Pan module (APPLE domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_033_00103.1|PACid:22024573
Sequence length 802
Sequence
MTIRSKPWFLLSFVLLLSCDTNLCTGIDSITIGQSLSGNQTLISRGGTFELGFFKPGNSS
NNYYLGIWYKKISVLTVVWVANRNNPVKDPSSSKLTFLKDYGLLLLDQSGSRLWASCLTS
PTVGVLLDNGNLVLKDRSDSSLVIWQTFNHPTETWLPGARLGCNIYGFRNGLTSWRTSED
PSTGTFLLHAASKKTNLVLRNVHNSSSSSYTYWTWSWNGQSFTLMDTSILKYVNFSFVSN
GNVSYFNYSVYNSSIPTRIVMDSFGRVQLLMWAEDSKIWDSIVLHIDICGSNSWKNGGHD
CQCLTGFEPRFPKEWNSGSWSGGCVRKKKLQCPYQGKNKFFVMSSINVANNSNNYVVESI
GKCKKLCLTTCYCNAYAYAYSSLCMIWSDDLFFLQKFKRNDIRRDLHVLVELTGSGNDVR
EKIYMVVGSIGGIILLGILLLIVRKCRRKKIRDPSAGTQQDYLHSFKYMELHRATRNFSE
QLGKGSFGCVYRGTLPDSTAIAVKTLRCQLSGEKQFRAEVNTIGMIQHKNLIRLRGFCAE
GTKRLLVYDYMPNSSLNQYLFQKDFKTLAWKTRYNIALGIARGLAYLHEKCRDCIIHCDI
KPENILLDAEFNPKVADFGLAKLLGRDFSRVLTSMRGTRGYLAPEWLSGVAITRKSDVYS
FGMMLFEIISGRRNLDMAVDDLIDYFPARVAIKISNGEEVIGLLDPMLDGNAELEELVRV
CRVACWCIQNDEKDRPSMGHIVQVLEGGLDVNTPPIPSFLQLILDFRKDQEHRDFFLEAN
TNNSGQHAFTGNCYAYKRSEHK
Download sequence
Identical sequences A0A2G5CZF9
Aquca_033_00103.1|PACid:22024573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]