SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_033_00108.2|PACid:22024523 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_033_00108.2|PACid:22024523
Domain Number 1 Region: 577-806
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.5e-44
Family WD40-repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 71-130,241-339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000285
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_033_00108.2|PACid:22024523
Sequence length 847
Sequence
MEDRSESDLEDTDSSVQLSVGAVSSRGLDLVQGDILSMSAAATNSNRGCNEVLHKVGSSG
NFANDVAESSVALTIENGNVNLRQWLDKPKRSVNVLECFHIFRQIVEIVNSAHSQGIVVH
NARPSCFEVSSFNRVSFVEPLSCSSRGSDLCGDALNIKIAEGQCSSHFLHKFHNESSRMP
CLDSNLDLYSPDASQMHNATSSLQSGSDNAKHLSSVAESEARNGAASRNLENIEESKKHL
TQKNILHEEIGWYTSPEEIAGASGSFSSDIYRLGVLLFELFCTFCSTEEKLTTMTNLRHR
VLPPQLLLKWPNEASFCLWLLHPQSSTRPKMSDLLQSEFLNEQREKHEAMLNLRQEIEEQ
ELLLDFLLQMQQRKSDSSNKLLNTICWISSDIEEVLKQQTNLKNNAGSDPEPNKNGRSES
KNPDLQSWDVLMNGDLASSGPRKRFKKEARSSHEENFVRDLGNVQKSDTIMKEHVRSKSM
RLMKNFKKFESVYISTRCGMTKATGKVSNRYSEINSSGRGSNMISGRSSVDNIGFSPGIG
RVGKHAWIINPFLEGLNNYLSFSNLKIRADLKQGDLLNSSNLVCSLSFDRDKEFFASAGV
ARKIKVYEYDIILNEDRGIHYPVIEMASKSKISNICWNSYIKSQIASCDFEGVVQIWDVT
RGQILTEMMEHERRVWSVDFSSADPTKLASGSDDGAVKLWNINQGGSIGTIKAKANVCCV
QFPPDSARSLVFGSADHKIYCYDLRNTKMPWCTLMGHTKTVSYVKFVDSASLVSASIDNS
VKLWDLSSCTSQVLNNPLQTFTGHTNVKVKSLMILIKFIDSYKLKEDIFSILWLWLWKFH
TSHTLFI
Download sequence
Identical sequences A0A2G5CZH3
Aquca_033_00108.2|PACid:22024523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]