SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_033_00108.4|PACid:22024525 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_033_00108.4|PACid:22024525
Domain Number 1 Region: 576-711
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.16e-22
Family WD40-repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 71-130,241-339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000021
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_033_00108.4|PACid:22024525
Sequence length 735
Sequence
MEDRSESDLEDTDSSVQLSVGAVSSRGLDLVQGDILSMSAAATNSNRGCNEVLHKVGSSG
NFANDVAESSVALTIENGNVNLRQWLDKPKRSVNVLECFHIFRQIVEIVNSAHSQGIVVH
NARPSCFEVSSFNRVSFVEPLSCSSRGSDLCGDALNIKIAEGQCSSHFLHKFHNESSRMP
CLDSNLDLYSPDASQMHNATSSLQSGSDNAKHLSSVAESEARNGAASRNLENIEESKKHL
TQKNILHEEIGWYTSPEEIAGASGSFSSDIYRLGVLLFELFCTFCSTEEKLTTMTNLRHR
VLPPQLLLKWPNEASFCLWLLHPQSSTRPKMSDLLQSEFLNEQREKHEAMLNLRQEIEEQ
ELLLDFLLQMQQRKSDSSNKLLNTICWISSDIEEVLKQQTNLKNNAGSDPEPNKNGRSES
KNPDLQSWDVLMNGDLASSGPRKRFKKEARSSHEENFVRDLGNVQKSDTIMKEHVRSKSM
RLMKNFKKFESVYISTRCGMTKATGKVSNRYSEINSSGRGSNMISGRSSVDNIGFSPGIG
RVGKHAWIINPFLEGLNNYLSFSNLKIRADLKQGDLLNSSNLVCSLSFDRDKEFFASAGV
ARKIKVYEYDIILNEDRGIHYPVIEMASKSKISNICWNSYIKSQIASCDFEGVVQIWDVT
RGQILTEMMEHERRVWSVDFSSADPTKLASGSDDGAVKLWNINQAILLLHFVDVSFENKC
TGDIELSVLSIELKW
Download sequence
Identical sequences A0A2G5CZG8
Aquca_033_00108.4|PACid:22024525 Aquca_033_00108.5|PACid:22024526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]