SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_033_00108.7|PACid:22024527 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_033_00108.7|PACid:22024527
Domain Number 1 Region: 382-692
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.98e-52
Family WD40-repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 57-151
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000723
Family Protein kinases, catalytic subunit 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_033_00108.7|PACid:22024527
Sequence length 695
Sequence
MHNATSSLQSGSDNAKHLSSVAESEARNGAASRNLENIEESKKHLTQKNILHEEIGWYTS
PEEIAGASGSFSSDIYRLGVLLFELFCTFCSTEEKLTTMTNLRHRVLPPQLLLKWPNEAS
FCLWLLHPQSSTRPKMSDLLQSEFLNEQREKHEAMLNLRQEIEEQELLLDFLLQMQQRKS
DSSNKLLNTICWISSDIEEVLKQQTNLKNNAGSDPEPNKNGRSESKNPDLQSWDVLMNGD
LASSGPRKRFKKEARSSHEENFVRDLGNVQKSDTIMKEHVRSKSMRLMKNFKKFESVYIS
TRCGMTKATGKVSNRYSEINSSGRGSNMISGRSSVDNIGFSPGIGRVGKHAWIINPFLEG
LNNYLSFSNLKIRADLKQGDLLNSSNLVCSLSFDRDKEFFASAGVARKIKVYEYDIILNE
DRGIHYPVIEMASKSKISNICWNSYIKSQIASCDFEGVVQIWDVTRGQILTEMMEHERRV
WSVDFSSADPTKLASGSDDGAVKLWNINQGGSIGTIKAKANVCCVQFPPDSARSLVFGSA
DHKIYCYDLRNTKMPWCTLMGHTKTVSYVKFVDSASLVSASIDNSVKLWDLSSCTSQVLN
NPLQTFTGHTNVKNFVGLSVWDGYIATGSETDEVFIYHKAFPMPMLSFQFSSMDTLSGHE
EDDATQFVSSVCWQGKSPVLVAANSTGNIKLLEMI
Download sequence
Identical sequences A0A2G5CZH2
Aquca_033_00108.6|PACid:22024529 Aquca_033_00108.7|PACid:22024527 Aquca_033_00108.8|PACid:22024528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]