SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_033_00143.1|PACid:22024620 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_033_00143.1|PACid:22024620
Domain Number 1 Region: 45-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.64e-36
Family ABC transporter ATPase domain-like 0.0000315
Further Details:      
 
Weak hits

Sequence:  Aquca_033_00143.1|PACid:22024620
Domain Number - Region: 2-44
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00012
Family DNA repair protein MutS, domain III 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_033_00143.1|PACid:22024620
Sequence length 331
Sequence
MERAITRDLVTHILLFSSHLLKAVNFSAELDCFLALALVARQNNYVRPILTEETMLDIHN
GRHVLQEMTVDTFVPNDTKILSDGRINIITGPNYSGKSIYIKQVALIVYLSHIGSFVPAE
AATIGLTDRIFCAMGSKYMTAEQSTFMIDLHQVGIMLRQATSQSLCLLDEFGKGTLAEDG
IGLLGGTINHFATCGDSPMVLVCTHLTEIFNESCLVKSEKIKFYTMSVLRPDENSTDVED
IVFLYRLVPGHTLLSYGLHCALLAGVPEEVLKRAASVLEIIATNKQVERQCNERILAKDQ
LYKAAVDKMLAFDVKKGDLNLLFQDIFPVES
Download sequence
Identical sequences A0A2G5D0M4
Aquca_033_00143.1|PACid:22024620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]