SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_033_00144.1|PACid:22024632 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_033_00144.1|PACid:22024632
Domain Number 1 Region: 265-407
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.89e-25
Family DNA repair protein MutS, domain III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_033_00144.1|PACid:22024632
Sequence length 433
Sequence
MKVNQSGRRRLIDLITKVLQSTLERAEKKNIRAMELETMEMEEVDETESQISWNIKFDYQ
NSKSEFQVYMACIMQGHRIGISYYDSTIRQLYVLEVWEDGSADFPLLDLAYFHWFDFLHS
WFYTANCSVRTIDPVKYQAKPSIIYASTKSDEFFLSALQRNDGNEVLPVKLIKSSLFSYE
QAWHRLIYLRVTGMDDGLSIKERICFLNCMMDVGSDVQVRASGGLLAILQNERLVDTLEQ
SEGGNASITIDCVTEISLNNFLKLDAAAYESLQIFQIDKHPSHMGIGRAKEGFSVFGMFN
KCVTPLGRRLLRSWFLRPILDLDVLNNRLNTISFLLCSEEVLTTLRETLKTVRDIPHILK
KFSSPSSICASGDWTAFLKSICSLLHINKIFEVGISESLREHMKYLNLSMVEKAGSCITT
ELVYVYELVSFEF
Download sequence
Identical sequences A0A2G5CZP5
Aquca_033_00144.1|PACid:22024632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]