SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_034_00198.1|PACid:22056720 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_034_00198.1|PACid:22056720
Domain Number 1 Region: 110-222
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.2e-16
Family Polyphosphate kinase C-terminal domain 0.055
Further Details:      
 
Domain Number 2 Region: 359-509
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000000000471
Family Polyphosphate kinase C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_034_00198.1|PACid:22056720
Sequence length 519
Sequence
MIITTITITRASITIFLSSLFLTLTCNTEAAGCKAWLVQSIPTDMPDLPRIPGILSTADV
FQWLAGNSSENLDIIALKWQLLSQPANPKSGDYGYSQANMEKFGANAGFQVYQSIQDTAD
RNVGVRILQHSGVYPDYTEESSMLASGRPNVENVTLLLTDWWESSGGVHSKVWISDHKHF
YIGSADNDWKSLTQVKEVGIYVVDCPRIAEKVEDYFNNLWKLASLNSSDYTKTVWDQQWQ
VYRKVPCWSHFIRTRERCRSPLPRYLEVPHVAGYPTLADPHIFEIPIETPGYSSPSSSHK
NHSSYLSFAPPELLFGTFQTDEQAWVDTITSVGWGETVRISAFDWLGQSQSMEQPVYWSS
ISSAISEVVFSKHAKVQILITYWPHKINNTEQYLYSLLYSNILCSSSKYNHCTGKIEIKY
YNVPGFSRTGAAIINGLSTDNIYPGKTRVNHAKYVVSNSRAHIGTSNFKWDHFYTTSGVS
FGTYNPAIVSQLQEIFDADWNSPYTVPFKLQEGALISYS
Download sequence
Identical sequences A0A2G5CXY3
Aquca_034_00198.1|PACid:22056720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]