SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_034_00303.2|PACid:22056975 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_034_00303.2|PACid:22056975
Domain Number 1 Region: 26-268
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.71e-62
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.00000438
Further Details:      
 
Domain Number 2 Region: 269-413
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 1.44e-54
Family Succinyl-CoA synthetase domains 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_034_00303.2|PACid:22056975
Sequence length 417
Sequence
MRGLISKIASKSLSVAGKWQQQQLRRLNIHEYQGAELMGKYGINVPKGVVVTSADQVQKA
IQDAFPNQTESQILAGGRGLGTFKSGLNGGVHIVKSNEVEDIAGKMLGQILVTKQTGPQG
KVVSKVYLCEKMSLVNEMYFAITLDRTTCGPLIIACKKGGTSIEDLAEKFPDMIIKVPID
VFKGITDEDAAKVVDGLAPKVADRKDSMEQVKKLYKLFCACDCTMLEINPIAETSDNKLV
AADAKLNFDDNAAFRQKEIFALRDSSQEDPREVAAAKADLNYIGLDGEIGCMVNGAGLAM
ATMDIIKLHGGTPANFLDVGGNASENQVVEAFKILTSDEKVKAILVNIFGGIMKCDVIAS
GIVNAAKQVALKVPVVVRLEGTNVDQGKRILKESGMTLITAEDLDDAAEKAVKASAS
Download sequence
Identical sequences A0A2G5CYH0
Aquca_034_00303.2|PACid:22056975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]