SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_034_00320.1|PACid:22056491 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_034_00320.1|PACid:22056491
Domain Number - Region: 45-90
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0311
Family DNA-binding N-terminal domain of transcription activators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_034_00320.1|PACid:22056491
Sequence length 212
Sequence
MNIFAKKPTAKEALRSSKREMTNATRGIEKEIGALQLEEKKLVAEIKRTAKTGNEAATKI
LARQLVRLRQQIANLQGSRAQMRGIATHTQAMYANTAVSTGMKGASKAMAAMNKQMAPAK
QAKVIQEFQRQSAQMDMTTEMMSDAIDDALDNDEAEEETDELTNQVLDEIGVDVASQLSA
APKGKIAGKKTEDVGSSGVDELEKRLAALRNP
Download sequence
Identical sequences A0A2G5CYJ5
Aquca_034_00320.1|PACid:22056491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]